Protein Info for BPHYT_RS07505 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 71 to 97 (27 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 37 to 232 (196 residues), 54.9 bits, see alignment E=1.1e-18 amino acids 251 to 450 (200 residues), 49.9 bits, see alignment E=3.7e-17 PF07690: MFS_1" amino acids 40 to 311 (272 residues), 55.7 bits, see alignment E=6.1e-19 amino acids 303 to 439 (137 residues), 41.5 bits, see alignment E=1.3e-14 PF13347: MFS_2" amino acids 169 to 384 (216 residues), 36.7 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1520)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2X3 at UniProt or InterPro

Protein Sequence (453 amino acids)

>BPHYT_RS07505 major facilitator transporter (Burkholderia phytofirmans PsJN)
MDYSATPQPAGTEALSMQSTPAAQPVERTSHVKAIAAITLGNGLEFFDFTIYSFFATIIG
KLYFPVEGQLAQLMLAVGTFGVGFIMRPVGGIVLGAYADRAGRKAAMSLTLWLMTLGSAI
IAFAPTYAAIGVAAPLLVILARLIQGFALGGEVGASTSLLLEYGSNKTRGFYGSWQFVSQ
GLNTVCGSLLGVALAAALSTAALESWGWRVPFVIGMAMGPIGIYIRRHLNETLPGVEDGA
AGSQPGSQPVSQPVRKLFREHSRVITTGVLTTIGGTAANYIVLFYLSTYAIRILHLPMSS
ALWAAWTAAVVTVICSPFAGALSDRVGRKRVLWVSRVLLIAAVYPAFMMINASPTVPVLL
AVVAGLAVLVAFTAVPNIVMLPEMFPREIRATGMSIVYCLGVSIFGGFAQFFATWLIQVS
GSNLAPAWYLIGCGVVSLLPLPFMRETAGRDIG