Protein Info for BPHYT_RS07475 in Burkholderia phytofirmans PsJN

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 416 to 433 (18 residues), see Phobius details amino acids 448 to 467 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 17 to 446 (430 residues), 169.3 bits, see alignment E=6.6e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1514)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2W8 at UniProt or InterPro

Protein Sequence (487 amino acids)

>BPHYT_RS07475 nitrate reductase (Burkholderia phytofirmans PsJN)
MSSNSITQVETFGFERIPDRSRYARPIDLFRLLFGGCNTFSTSVLGSFPVLLGLSFKAGV
WSIVLGVLIGSCILAPMSLFGPRNGTSDPVSSGAHFGIHGRIVGSFLAVLTAVAFFSLAV
WSSGDALVGGANHLLGLPVNWMTLSFAYGLFAVLVLTVCVYGFRFMLWVNKIAVWAASIL
FVVGLFAFTKSFDGAYAGKVALGSVGFWPAFVSAVLVAMSNPVSFACTLGDWARYIPENT
PRKRTILAVMLAQLATFVPFFFGLATATIIASKAPDFIASNNYVGGLLAISPNWFFLPVC
LIAIIGGMSTGTTALYGTGLDMSSMFPKFLNRVRATLLIGSLAIGFIFLGRFAFNLVESV
STFSVLINVCSCPWMVIMIIGFVTRRGFYLSDDLQVFNRGGRGGHYWFTHGWNWRAMGAW
IPSAAISLCFVNLPDQFVGPLGQLAGGLDISMPVSLTLAAALYIALLQCFPEPDGVYGPQ
GRRWLRG