Protein Info for BPHYT_RS07435 in Burkholderia phytofirmans PsJN

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 122.1 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 39% identical to ARGO_YERPY: Arginine exporter protein ArgO (argO) from Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to bpy:Bphyt_1506)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2V9 at UniProt or InterPro

Protein Sequence (205 amino acids)

>BPHYT_RS07435 amino acid transporter (Burkholderia phytofirmans PsJN)
MNWLSFSDGAALCASLIVTIGAQNAFVLRQGITRSHVGKIVALCALSDFILIGAGVGGAA
VLVERYPVFVHAMLYVGLAYLAWFGINALRRAVRPEHAVMDGENVSAAPEQRAVPIILMT
LAFTWLNPHVYLDTFLLIGTAGAREPEGARVAFALGAMAVSGIWFIGLGYGARALAPLFK
RATAWRVLDGAIGSMVLLLAVTQLR