Protein Info for BPHYT_RS07390 in Burkholderia phytofirmans PsJN

Annotation: transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 23 to 50 (28 residues), see Phobius details amino acids 60 to 60 (1 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 362 to 388 (27 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details PF16933: PelG" amino acids 1 to 453 (453 residues), 520.5 bits, see alignment E=2.2e-160

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1497)

Predicted SEED Role

"Extracellular Matrix protein PelG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2V0 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BPHYT_RS07390 transmembrane protein (Burkholderia phytofirmans PsJN)
MAGIGFELRKIMRRDTLTGVARAYAYAGLISSGPLILSIFGILIIGLISLTSVIPTFAIV
QFQVSVTYLIALSLILTGPLQLSFTRFISDRLFEKRDDLVLSNYNGVVLVSSMLASVVAV
VAMLVGFREEPLIYRLLMITGFVVVSNIWIAVIFLSSVKQYRQILMVFAVGYACVVCLAL
ALNGYGLVGLLGGFVAGHIVLLAGLSGLIYRNYRSERFVSFEVFERRFAYPSLALVGLLF
NIGVWLDKFMFWYAPGTGTRVIGPLHASVIYDIPIFIAYVCVMPGMATFLVRIEADFVEY
YDAFYDAVRSGATLRHINEMRDMMVGSVRAGLYEIIKVQAVVLLLIVAFGERVLGSLGIS
PLYMPLLVVDVVSASLQVLLLGLLNVFFYLDGRRMVLRLTGAFVVLNGLFTGITLRLGPD
FYGYGFALALLVVVVAAVKVLDRKFMSLEYETYMLRG