Protein Info for BPHYT_RS07385 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 PF11997: DUF3492" amino acids 13 to 293 (281 residues), 354.6 bits, see alignment E=1.4e-109 PF13439: Glyco_transf_4" amino acids 166 to 306 (141 residues), 32.4 bits, see alignment E=2.7e-11 PF00534: Glycos_transf_1" amino acids 316 to 475 (160 residues), 75.5 bits, see alignment E=1.1e-24 PF13692: Glyco_trans_1_4" amino acids 321 to 471 (151 residues), 77.4 bits, see alignment E=4.1e-25 PF13524: Glyco_trans_1_2" amino acids 405 to 499 (95 residues), 26.2 bits, see alignment E=2.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1496)

Predicted SEED Role

"Extracellular matrix protein PelF, glycosyltransferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2U9 at UniProt or InterPro

Protein Sequence (550 amino acids)

>BPHYT_RS07385 glycosyl transferase family 1 (Burkholderia phytofirmans PsJN)
MMKELPIRRAADADVCLLLEGTFPFVRGGVSSWVNEMIRSYPETRFAIVFIGSREQDYNG
AAYVLPDNVVHIETHFLYEQAVADFQPRAVAGDAAAFARSQKLHDALRDPRSGLDVGGLM
ASMIPMLGANGALNEQQFLSSRAAWDTIVDQYQKYCTDPSFTDYFWTVRIMHKPLWQLAR
VAEKLLPAKVYHTVSTGYGGFLGALMHYRTGRPLLISEHGIYTKERKIDLLQSQWIRDNR
GVFERDISRVSYFRELWVRFFEAIGKLAYDAADDIVALYEANRQRQITDGARAERTQCIP
NGIDVDALGPLVAQRKPRSHRVVALIGRVVPIKDIKTFIRAIFIASRTMPDLEGWIIGPE
EEDPAYALECRALVESLGLSRNVKFLGFQRIDDMMPQIDVIALTSISEALPLVVLEGFAA
GVPAITTDVGSCRQLIEGVDAEDRALGSAGAVVQLADPAAFAQAVLALLADETRWQAAQQ
AGLARVRRYYTKKQMIDRYRALYERLAAMPDRERNYSAADAARCPMHHGTQSKAEPHASP
AHPVQSQETR