Protein Info for BPHYT_RS07280 in Burkholderia phytofirmans PsJN

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details PF13520: AA_permease_2" amino acids 22 to 446 (425 residues), 124.9 bits, see alignment E=4.2e-40 PF00324: AA_permease" amino acids 27 to 456 (430 residues), 325.5 bits, see alignment E=5.7e-101

Best Hits

Swiss-Prot: 38% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1474)

MetaCyc: 36% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2S8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>BPHYT_RS07280 amino acid permease (Burkholderia phytofirmans PsJN)
MTQEQRGFDTIVEREKGLQRGLSTGQLSMIAIGGAIGTGLFLGSGFAIGFAGPSVLVSYA
IGALIALLLMGCLAEMTVAHPTSGSFGAYAEHYIAPWAGFLVRYAYWSSIVFAVGTEVTA
IAVYMKYWFPAVPGWYWIVGFSAALIGINSVSVKVFGAVEYVFSMLKIVAIVGFILLGAY
VVFGAPADSTIGFANYTSHGGFFPKGVWGMWVAVIVSIFSYLSIEMIAVAAGEARDPQKA
ITRAFRATMFRLVFFYLLTLALMLAIVPWNAAGTDESPFVRVMAATHVPGAAGVINFVIL
VAALSAMNSQLYITTRMMFSLSRAGYAPRKLGALNGKGVPVAALWLSTIGIALATVLNVV
YPDASFVLMMSVSMFGAMFTWLMIFVTHFFFRHRHQGAPLAFRMWGYPGTSALGAGLMVS
ALVTTWFTREFRMTLVIGVPFIVSLLVVYFVWYRKRAVEGAAAELA