Protein Info for BPHYT_RS07275 in Burkholderia phytofirmans PsJN

Annotation: kynureninase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR01814: kynureninase" amino acids 7 to 392 (386 residues), 313.5 bits, see alignment E=1e-97 PF00266: Aminotran_5" amino acids 30 to 311 (282 residues), 71.9 bits, see alignment E=5e-24 PF01041: DegT_DnrJ_EryC1" amino acids 81 to 201 (121 residues), 28.5 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 51% identical to KYNU_BURMS: Kynureninase (kynU) from Burkholderia mallei (strain SAVP1)

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 100% identity to bpy:Bphyt_1473)

MetaCyc: 51% identical to kynureninase subunit (Pseudomonas fluorescens)
Kynureninase. [EC: 3.7.1.3]

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.3

Use Curated BLAST to search for 3.7.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2S7 at UniProt or InterPro

Protein Sequence (409 amino acids)

>BPHYT_RS07275 kynureninase (Burkholderia phytofirmans PsJN)
MITREHCAALDAADTLAHCRARFDLPADTIYLDGNSLGAMPANVPARIEQALKHEWAHGL
IRSWNDAGWYPAPQRTGNKIARLIGAGQDEVIVADSTSVNLFKVLVAATRMRPGRNVILA
ERTNFPTDVYIASSVAEMTGCDLRCVDPDEIVSAIDDTVAIVSLTHVNYKTGKRYDMEAV
TRQAQEAGALIVWDLCHSAGAMPVNLNRCDADFAVGCGYKYLNGGPGAPAFVFVASRHIE
AVRQPLTGWHGHSRPFEFAHDYAPHPGIDRMLTGTAPQLGVIALESALEAFDGVDLDVLR
DKSVALGNLFIELTDQELTGLGCTLASPRDAEMRGSQVSLGHAQGYAIMQALIARNVIGD
FRAPDILRFGFAPLYVRYVDIWDTIAQLKDIIATDAWNTDEFKARKSVT