Protein Info for BPHYT_RS07210 in Burkholderia phytofirmans PsJN

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 134 to 150 (17 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details PF00892: EamA" amino acids 160 to 290 (131 residues), 57.8 bits, see alignment E=6.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1460)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2R4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BPHYT_RS07210 permease (Burkholderia phytofirmans PsJN)
MQDTTLQPALNSAQTSVKPARGAAGAALLCVLSMSCVQFGAALSAPTMAMYGSLSTTWLR
LCWAALVLALLVRPRFLSYSRAHWTAAGVLGAAMAGMTLCFFAALQRIPLGLAVAIDFLG
PLAVATFAVRRARALLWPVLAIAGVILLSRDRAGWIGEPLGVLLACGAALGWGTYIVLMK
KTGTLFAGLEGLSVSLIAAALVATPFGLAQSGLHVTAGQVAATAGLALLVPLLPYALEMV
ALRHMPAASFGILMSVEPAIGALAGFVVLHQPMGILQIMGTLLVVTASVGAVMVAR