Protein Info for BPHYT_RS07105 in Burkholderia phytofirmans PsJN

Annotation: CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 174 to 193 (20 residues), see Phobius details PF02515: CoA_transf_3" amino acids 14 to 376 (363 residues), 421.9 bits, see alignment E=1.2e-130

Best Hits

Swiss-Prot: 42% identical to ACOCT_ACEAC: Acetyl-CoA:oxalate CoA-transferase (uctC) from Acetobacter aceti

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1436)

MetaCyc: 44% identical to acyl-CoA:3-sulfinopropionate CoA-transferase (Variovorax paradoxus)
2.3.1.-

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.16

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2P0 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BPHYT_RS07105 CoA transferase (Burkholderia phytofirmans PsJN)
MTAPLQNDGAKGALQGLKVIDLSRVLGGPYCTQALADHGAQVIKLEPPNGDETRGWGPPF
YGDTAWYFAGVNRNKQGIAVDLSREEGRAILWKLLEDADVLVENFKPGTLERWGMDYERD
LRERFPKLIHCAVSGFGPDGPLGGLPGYDAAIQAMTGLMSVNGERDGPATRVGLPVVDMV
TGLNALAGILLALAERAKSGRGQSIDIALYDCGVSLLHPHLPNYFGSGRTPQRSGNAHPN
ITPYDSYRTATAPIFLAVGNDRQFAKLCAHLGAPELADDPRYVDNRSRCAHREPLKAALE
SLLTAHECEPLAHALINAGVPCGPVQTVDVVARHPHTLHRGLVVEMGEYRGTASPIKLSR
TPATYRSAPPSLGADTRDVLDKLGIDAATQQRLLESGVLRA