Protein Info for BPHYT_RS07065 in Burkholderia phytofirmans PsJN

Annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to SDR1_PICAB: Short-chain type dehydrogenase/reductase from Picea abies

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to bpy:Bphyt_1428)

MetaCyc: 41% identical to aldehyde reductase (chloroplastic) (Arabidopsis thaliana col)
Aldehyde reductase. [EC: 1.1.1.21]; Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.21, 1.1.1.2]; 1.1.1.2 [EC: 1.1.1.21, 1.1.1.2]; 1.1.1.- [EC: 1.1.1.21, 1.1.1.2]; 1.1.1.- [EC: 1.1.1.21, 1.1.1.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
palmitate biosynthesis III (28/29 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
oleate biosynthesis IV (anaerobic) (13/14 steps found)
palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
biotin biosynthesis I (13/15 steps found)
cis-vaccenate biosynthesis (5/5 steps found)
fatty acid elongation -- saturated (5/5 steps found)
gondoate biosynthesis (anaerobic) (4/4 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
L-arabinose degradation II (3/3 steps found)
(5Z)-dodecenoate biosynthesis I (5/6 steps found)
stearate biosynthesis II (bacteria and plants) (5/6 steps found)
8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
(5Z)-dodecenoate biosynthesis II (4/6 steps found)
stearate biosynthesis IV (4/6 steps found)
methylglyoxal degradation III (1/2 steps found)
glycerol degradation to butanol (11/16 steps found)
L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
pyruvate fermentation to butanol I (4/8 steps found)
superpathway of methylglyoxal degradation (4/8 steps found)
D-xylose degradation to ethylene glycol (engineered) (1/4 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
petroselinate biosynthesis (2/6 steps found)
detoxification of reactive carbonyls in chloroplasts (4/10 steps found)
2-allylmalonyl-CoA biosynthesis (2/8 steps found)
streptorubin B biosynthesis (20/34 steps found)
traumatin and (Z)-3-hexen-1-yl acetate biosynthesis (3/12 steps found)
superpathway of pentose and pentitol degradation (22/42 steps found)
superpathway of lipoxygenase (4/22 steps found)
mycolate biosynthesis (25/205 steps found)
superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.2 or 1.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2N2 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BPHYT_RS07065 3-ketoacyl-ACP reductase (Burkholderia phytofirmans PsJN)
MNTLNNAQVAIVTGASRGIGAAVAQRLAKDGFAVAINYASSSAEADHLVAGLTAAGAKAI
AVKADVSNTNDVRRLFEITEQQLGKVDVLVNNAGVLKTVPLADTSDALYDQTFGINVRGT
FNTLREAAARMNDGGRIVNFSSTTLALNMPGYAIYNATKAAVEAFTHVFAKELRGRNITV
NAVAPGPIATLLFLDGKTEEQVQTFAKMPPLQRLGQPDDIASVVAFLAGPDAGWVNGQIL
RANGGLA