Protein Info for BPHYT_RS07035 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00126: HTH_1" amino acids 12 to 68 (57 residues), 70.3 bits, see alignment E=1e-23 PF03466: LysR_substrate" amino acids 94 to 302 (209 residues), 137.6 bits, see alignment E=4e-44

Best Hits

Swiss-Prot: 44% identical to LTRA_KLEPN: Probable HTH-type transcriptional regulator LtrA (ltrA) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1422)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2N0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>BPHYT_RS07035 transcriptional regulator (Burkholderia phytofirmans PsJN)
MTPNELFALLPDMAVFARVVDAGNFSVAARQLGSTPSTVSRQIKRLEDALATRLLERSTR
TVRVTESGAQVVRFCRDMVSAASGAVDAAGQLAGRPQGKVSVSAPTQFARSVIHPLIAGF
LRAYDEVDLQLLFTDHDVDPLADDVDLVIRLTEHPPQGLAGRRLGAVRWLLVASPAYLRE
RGTPAQPRDLHKHACIYLGETADDNRWRFRRGTETQSVDVKGRYIANHAGARLEAALQDF
GVACVPEFAAADSLQSGALVQVLPDWNLEARAYVGSVWLLYPPNRFLPPKVRALIDYLVE
HLHDTLDTA