Protein Info for BPHYT_RS06925 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 65 to 91 (27 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details amino acids 442 to 465 (24 residues), see Phobius details PF12801: Fer4_5" amino acids 66 to 106 (41 residues), 39.4 bits, see alignment 2.4e-14 amino acids 158 to 186 (29 residues), 21.1 bits, see alignment (E = 1.2e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1400)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2K4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>BPHYT_RS06925 membrane protein (Burkholderia phytofirmans PsJN)
MSTVMTRPGRLAAAGQWMQRHGAAIRGIQWVVVAVYAFLILVPAVMPLPDDSAHLWNNLT
LAAQFVFWGIWWPFVLLSMVMLGRVWCGVLCPEGALAEFASKYGRGRAIPHWMRWGGWPF
VAFGITTIYGQMVSVYQYPKAVLLVLGGSTFAAMIIGLLYGREKRVWCKYLCPVNGVFSL
LARLAPFHYKVDEEAWRRSYKNGEHGHRVIPINCAPLVPLRNMKGASDCHMCGRCSGHRD
AIALTWRAPSSEVVQLGDKQANPWDTALILYGLLGIAIGAFHWTASRWFVDLKIFLANWL
VDHDITWPLDTNAPWFLFTHYPEQNDVFSWLDGTMVIGYILATALVYGTVLLVLLMGATR
MLGRFNGVRLHHLTQGLIPIAGAGVFLGLSATTLSLLRAEHVSLWWASDMRIAILAIANL
WSAWLAWLVTRRYSERFVQRGLAMVWFAAALAVVDSAWWLMFWGWASK