Protein Info for BPHYT_RS06920 in Burkholderia phytofirmans PsJN

Annotation: iron permease FTR1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF03239: FTR1" amino acids 3 to 264 (262 residues), 117.1 bits, see alignment E=4.8e-38

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to bpy:Bphyt_1399)

MetaCyc: 51% identical to ferrous iron uptake system, inner membrane protein FtrC (Brucella abortus 2308)

Predicted SEED Role

"High-affinity iron permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2K3 at UniProt or InterPro

Protein Sequence (281 amino acids)

>BPHYT_RS06920 iron permease FTR1 (Burkholderia phytofirmans PsJN)
MGQILFIVWRESVEALLVVGILYAWLKNGDDDARRGLPYLWGGVAAGLIAAVALGAALVG
FTEVLSGDAQDYFQTAMVLVACVLIVQMVLWMKQHGRTLKRDMEQSLQKSQRDSNWWGVA
LLVALAIAREGSETVIFLYGLGFGQSGHVGASQMLAVVIGLALAFLTFYILQLGGKIFSW
RLFFRITEIMLLFLGAGLFQTGVDKLIDKEILPTIIDQMWNSSAVLDDSSTFGSLVATLT
GYRAHPALMNLIAYAAYWGVVYLLLRRANRKPARQAAGRTA