Protein Info for BPHYT_RS06730 in Burkholderia phytofirmans PsJN

Annotation: MaoC family dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 67 to 83 (17 residues), see Phobius details PF01575: MaoC_dehydratas" amino acids 21 to 133 (113 residues), 96.4 bits, see alignment E=4.7e-32

Best Hits

Swiss-Prot: 48% identical to ECH1_MYCTO: Probable enoyl-CoA hydratase 1 (MT0138) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1365)

Predicted SEED Role

"MaoC domain protein dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2G9 at UniProt or InterPro

Protein Sequence (158 amino acids)

>BPHYT_RS06730 MaoC family dehydratase (Burkholderia phytofirmans PsJN)
MTGSAAPAATFRSAAALGELVGGEPLVSEWLTVDQASVDRFAEATGDHQWIHVDPERARR
ESPFGGPVAHGFLTLSLIPALLGKTVALEQRMGVNYGLNRVRFTSPVPVGSQLRAKFAVE
SVTEVDNNGVQVVWNVTLERQGSERPVCVAEFITRHYF