Protein Info for BPHYT_RS06670 in Burkholderia phytofirmans PsJN

Annotation: NADH:ubiquinone oxidoreductase subunit J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00499: Oxidored_q3
  • amino acids 19 to 169 (151 residues), 133.3 bits, E=2.8e-43

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 100% identity to bpy:Bphyt_1352)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See B2T2F6 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BPHYT_RS06670 NADH:ubiquinone oxidoreductase subunit J (Burkholderia phytofirmans PsJN)
MEFTTVLFYIFALLLVVSGLKVITSRNPVSSALFLVLAFFNAAAIWMLLQAEFLAILLVL
VYVGAVMVLFLFVVMMLDINIDVLRKDFKRFVPMATLVGAIIVIETALILWHGYGATATA
LRDTTAAANGMGDWSNTRLIGKVIYTDYIFAFEVAGLVLLVAIIAAIALTASHKKDSKRQ
NVSEQVKVRAQDRVRVVKMKSEKTAATVAAEEAAAAAAAAAADSAPAKNS