Protein Info for BPHYT_RS06635 in Burkholderia phytofirmans PsJN

Annotation: NADH-quinone oxidoreductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00329: Complex1_30kDa" amino acids 32 to 161 (130 residues), 154.9 bits, see alignment E=7.3e-50 TIGR01961: NADH (or F420H2) dehydrogenase, subunit C" amino acids 32 to 159 (128 residues), 140.8 bits, see alignment E=1.6e-45

Best Hits

Swiss-Prot: 100% identical to NUOC_PARPJ: NADH-quinone oxidoreductase subunit C (nuoC) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 100% identity to bpy:Bphyt_1345)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2E9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>BPHYT_RS06635 NADH-quinone oxidoreductase subunit C (Burkholderia phytofirmans PsJN)
MASKLETLKANLEAAFGGLLLNLSEAIGELTIVVKASDYLNVATRLRDDRSLGFEQCVDL
CGVDYQTYAEGAYDGPRFAAVLHLLSVQNNWRLRLRVFAPDDEVPILPSVVEIWNSVNWY
EREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTI
EPREITPRVIREDRYGGLKH