Protein Info for BPHYT_RS06615 in Burkholderia phytofirmans PsJN

Annotation: preprotein translocase subunit SecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 26 to 26 (1 residues), see Phobius details amino acids 31 to 31 (1 residues), see Phobius details transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 54 to 54 (1 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details TIGR00810: preprotein translocase, SecG subunit" amino acids 6 to 76 (71 residues), 91.3 bits, see alignment E=1.6e-30 PF03840: SecG" amino acids 7 to 76 (70 residues), 77.7 bits, see alignment E=3e-26

Best Hits

KEGG orthology group: K03075, preprotein translocase subunit SecG (inferred from 100% identity to bpy:Bphyt_1342)

Predicted SEED Role

"Preprotein translocase subunit SecG (TC 3.A.5.1.1)" in subsystem Murein hydrolase regulation and cell death (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2E6 at UniProt or InterPro

Protein Sequence (125 amino acids)

>BPHYT_RS06615 preprotein translocase subunit SecG (Burkholderia phytofirmans PsJN)
MLYLKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTA
VLAAVFFVTTLTLTYLGAYRAKPSAGVLGAAVTAPVAASAASAPAAGSAVLPASAASVPA
TDVPK