Protein Info for BPHYT_RS06565 in Burkholderia phytofirmans PsJN

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 230 to 246 (17 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 49 to 207 (159 residues), 77.3 bits, see alignment E=9e-26 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 57 to 218 (162 residues), 113.3 bits, see alignment E=5.8e-37

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to bpy:Bphyt_1332)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2D6 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BPHYT_RS06565 CDP-diacylglycerol--serine O-phosphatidyltransferase (Burkholderia phytofirmans PsJN)
MAAFKPRRPRNSGPLPRPFRRNKPMVTEAAVDSRRAQRQQFLRKRGIYLLPNAFTTAALF
CGFFAVVQAMNVRFEVAAIAIFVAMVLDGMDGRVARMTHTQSAFGEQFDSLSDMVSFGVA
PALVMYEWILKDLGRWGWLAAFVYCSGAALRLARFNTNIGVVDKRFFQGMPSPAAAALIA
GFVWLATDNRVPLKLVWLPWVAFVLTIYAGVTMVSNAPFYSGKALDVRHRVPFGVILLVV
VAFVLVSSDPPLMLFGLFVLYGLSGYVFWGYQAVRGRANPARSVSVDR