Protein Info for BPHYT_RS06560 in Burkholderia phytofirmans PsJN

Annotation: phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 13 to 45 (33 residues), see Phobius details TIGR00164: phosphatidylserine decarboxylase homolog" amino acids 7 to 210 (204 residues), 229.4 bits, see alignment E=1.5e-72 PF02666: PS_Dcarbxylase" amino acids 43 to 209 (167 residues), 159.7 bits, see alignment E=3.9e-51

Best Hits

Swiss-Prot: 100% identical to PSD_PARPJ: Phosphatidylserine decarboxylase proenzyme (psd) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to bpy:Bphyt_1331)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2D2 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BPHYT_RS06560 phosphatidylserine decarboxylase proenzyme (Burkholderia phytofirmans PsJN)
MNYPHPIIAREGWPFIAIAAVVALLVHFIAGFGFSWLFWLLLIFVVQFFRDPARPIPTQA
NAVLCPADGRIVAVETAHDPYANREALKISVFMNVFNVHSQRSPVDGAISKVEYFPGAYL
NAAVDKASTENERNAVVIEMAGGQTVTSVQIAGLIARRILCYVRAGEPLTRGQRYGFIRF
GSRVDVYLPVGSRPRVSIGEKVSASSTILAEL