Protein Info for BPHYT_RS06560 in Burkholderia phytofirmans PsJN

Annotation: phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 7 to 210 (204 residues), 229.4 bits, E=1.5e-72
• PF02666: PS_Dcarbxylase
  • amino acids 43 to 209 (167 residues), 159.7 bits, E=3.9e-51

Best Hits

Swiss-Prot: 100% identical to PSD_PARPJ: Phosphatidylserine decarboxylase proenzyme (psd) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to bpy:Bphyt_1331)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (11/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See B2T2D2 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BPHYT_RS06560 phosphatidylserine decarboxylase proenzyme (Burkholderia phytofirmans PsJN)
MNYPHPIIAREGWPFIAIAAVVALLVHFIAGFGFSWLFWLLLIFVVQFFRDPARPIPTQA
NAVLCPADGRIVAVETAHDPYANREALKISVFMNVFNVHSQRSPVDGAISKVEYFPGAYL
NAAVDKASTENERNAVVIEMAGGQTVTSVQIAGLIARRILCYVRAGEPLTRGQRYGFIRF
GSRVDVYLPVGSRPRVSIGEKVSASSTILAEL