Protein Info for BPHYT_RS06445 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 410 to 436 (27 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details amino acids 522 to 544 (23 residues), see Phobius details amino acids 565 to 587 (23 residues), see Phobius details PF03814: KdpA" amino acids 11 to 595 (585 residues), 766.5 bits, see alignment E=6.2e-235 TIGR00680: K+-transporting ATPase, A subunit" amino acids 242 to 595 (354 residues), 491.9 bits, see alignment E=1.3e-151

Best Hits

Swiss-Prot: 84% identical to KDPA_BURMA: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to bpy:Bphyt_1308)

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2B2 at UniProt or InterPro

Protein Sequence (601 amino acids)

>BPHYT_RS06445 ATPase (Burkholderia phytofirmans PsJN)
MNSNNVLQAGLFIVVLLAAAVPMARYLSAVMDGSSRVVRFGGPVERLLYRIAGVDASKEM
SWKHYAIATIAFNVLGVAFLYVLLRVQGWLPGNPQQFGPMTVDGAFNTAVSFVTNTNWQD
YTPEQTVGYLTQMLGFTVQNFFSAATGIVVVVALIRGFARHTAQTIGNFWVDLTRVTLYV
LLPMAAIVAALLMSQGVVQNFKAYQDVPTLQTTTYAAPKLDAQGNPVKDAKGNPVTVDTP
VKTQTLAMGPVASQEAIKMLGTNGGGFFNGNSAHPYENPTPFSNFLQIFSILIIPAALAL
VFGRMIADRKQGVAVLAAMTIAFAVCVFGEISAEQGGNPAIAALHVDQSANALQSGGNAE
GKETRFGIAQSGIFTVATTAASCGAVANTHDSLTPIGGLYPMLLMQLGEVIFGGVGSGMY
GMLVFAMLAVFVAGLMIGRTPEYVGKKIEAYEMKMVSIVVLLTPLLVLVGTSIAVLSDAG
KAGIANPGAHGFSEILYAFSSAANNNGSAFAGLTVSTPFYNWLTAIAMWFGRFGTIIPVL
AIAGSLAAKKRIGVTGGTLPTHGPLFVVLLLGTVLLVGALTYVPALALGPGVEHLIMMGA
H