Protein Info for BPHYT_RS06425 in Burkholderia phytofirmans PsJN

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR00160: methylglyoxal synthase" amino acids 1 to 123 (123 residues), 165.1 bits, see alignment E=4.9e-53 PF02142: MGS" amino acids 17 to 109 (93 residues), 57 bits, see alignment E=9e-20

Best Hits

Swiss-Prot: 76% identical to MGSA_BURMS: Methylglyoxal synthase (mgsA) from Burkholderia mallei (strain SAVP1)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 99% identity to bxe:Bxe_A3256)

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2A8 at UniProt or InterPro

Protein Sequence (129 amino acids)

>BPHYT_RS06425 methylglyoxal synthase (Burkholderia phytofirmans PsJN)
MTTRIALIAHDHKKDDIVKLAGEYVDTLRRCDIVATGTTGGRIADAHGLTVERMLSGPHG
GDLQIGAQLAEGRVDMVIFLRDPMTPQPHEPDINALVRACDVHNIPCATNISTARMVLDS
LTLRLTQQV