Protein Info for BPHYT_RS06410 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 319.8 bits, see alignment E=6.3e-100 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 114.3 bits, see alignment E=3e-37 PF01709: Transcrip_reg" amino acids 82 to 237 (156 residues), 217 bits, see alignment E=1.2e-68

Best Hits

Swiss-Prot: 100% identical to Y1301_PARPJ: Probable transcriptional regulatory protein Bphyt_1301 (Bphyt_1301) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1301)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2A5 at UniProt or InterPro

Protein Sequence (242 amino acids)

>BPHYT_RS06410 transcriptional regulator (Burkholderia phytofirmans PsJN)
MAGHSKWANIKHKKAAADAKRGKVWTRLIKEIQVAARMGGGDIDSNPRLRLAVEKAYDAN
MPKDNVNRAIQRGVGGVDGASYEEIRYEGYGIGGAAVIVDTMTDNRTRTVAEVRHAFSKN
GGNMGTDGSVSFMFDHVGQFLFAPGTAEDKLMEAALEAGADDVVTNDDGSIEVLCPPNDF
PKVKSALEAAGFKAELAEVTMKPQTEVEFTGEDAVKMQKLLDALENLDDVQEVYTNAAIA
DE