Protein Info for BPHYT_RS06345 in Burkholderia phytofirmans PsJN

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details PF00512: HisKA" amino acids 225 to 286 (62 residues), 32.4 bits, see alignment E=7.8e-12 PF02518: HATPase_c" amino acids 333 to 443 (111 residues), 81.2 bits, see alignment E=7.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1288)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T292 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BPHYT_RS06345 sensor histidine kinase (Burkholderia phytofirmans PsJN)
MTTSLAGLQSNYREELRDYRLLRSKAGGLTVIVLVLMGVALDYVVYPAEQKRFAIVRILT
SAAIGLALLSLYTQTGKRHVQVITFFWLLLPQAMISWMIYVTQGGESLFYAGLMLTIFAV
GILFPSGYWQTLAFGLATVLLYYVACAAHPGGIQNPSKFQFQLILIFFCALASSIYTYFN
EKGRFQLFRLKDEVAHKNDQLALTNENLAQIKGQLLQQEKMAAIGTLSAGLLHEVNNPVN
FCLMAIEIAMEEPQVKDSASLQECLTDVKQGMHRIQHIVSDLKTFAYRKPGAAADDVPFL
FEKALDSSIRLSAHELRGVSVTRELPGDTLVLGDEAAIIGVLINLFSNAALAMQKAGTVS
PKVHVTAQWRDDRLHVNVRDNGPGIAAENLARVFEPFFTTREVGQGLGLGLSISYAVVER
HGGTLFAESQLGEWTAFNFDLPRLE