Protein Info for BPHYT_RS06325 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 PF08446: PAS_2" amino acids 16 to 129 (114 residues), 71 bits, see alignment E=3.3e-23 PF01590: GAF" amino acids 159 to 320 (162 residues), 46.7 bits, see alignment E=1.2e-15 PF00360: PHY" amino acids 336 to 511 (176 residues), 169.3 bits, see alignment E=1.5e-53 PF00512: HisKA" amino acids 530 to 593 (64 residues), 33.7 bits, see alignment E=7.6e-12 PF02518: HATPase_c" amino acids 637 to 749 (113 residues), 74.3 bits, see alignment E=2.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1284)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T288 at UniProt or InterPro

Protein Sequence (791 amino acids)

>BPHYT_RS06325 ATPase (Burkholderia phytofirmans PsJN)
MADLNSSASSTVEADCAREPIQIPGGIQPHGFLFSISATGTLLQVSANTATLTGLPAEHA
LGQPIAQIVGDEWAERIVSTLATHQEEGIPLYVGSMNDPRANVAGSPAAPFAVIVHRYQG
VVIVELEPARGTLDVFSSMYPLVRTFINRLEDVQTVAGLAQLAADEVQRITGYGRTLVYS
FDGTGSGHVIAEHVEPGYASYADQHFPGSDIPAQARALYVRNRIRLIADADYRPAPLVPP
LHPSTGRPTDLTYASLRSVSPVHVQYMKNMGTLSSMSMSIVVRGKLWGLISCHHDTARVP
PFEVRTACEHIAQVLSLQIEAKEDHAEAEYRLELRRALARLLAVMANTDSFTDALAGDPQ
DLLGLTASDGAAIVFDGRVLLVGTTPSEPEVSKLVEWLDTQVDDTFATDTLATAYPALPV
NPDFAGVLAVSISKLFRNYVLWFRKEVVQTIKWAGDPRVKLASLSASLSPRESFAVWTDT
VRGRSPAWRPAELEIAVEFRTALLGIVLRRAEELAQLALELGRANKELEGFSYTVSHDLR
APLRHIVGFGDLLRQMESERLSARGNHFVERIISSARFGGKLVDDLLAFSQMGRAALRPQ
SVDVNAMTEALIADEVKDAPSRDIAWRVGALGHVTADAVLLHVVLRNLIENAVKFTSTRE
RAEIEIGRYAGDGELAGQDVFFVKDNGVGFDMRYVDKLFGVFQRLHRVEEFAGTGIGLAG
VKRIVERHGGKAWAAAEIDKGAAIYFSLPHVFAAAPAAGEKSPAAAMARLTALAPGKRFR
PVPKESKDESK