Protein Info for BPHYT_RS06260 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 369 to 392 (24 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 349 (341 residues), 71.5 bits, see alignment E=3.3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1271)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T275 at UniProt or InterPro

Protein Sequence (403 amino acids)

>BPHYT_RS06260 MFS transporter (Burkholderia phytofirmans PsJN)
MRVNHQAFFCSLFVARLADQVLLFLVPLVVFQTTHQVSWSGLAFFIETLPRYLVFPFFGA
LCDRISPLRLMRVSQTVRALACFGGILAYALFGGIGWLIALSAVCGVLTSQGLVAREVML
PQIFSTQQFQRVLAYSQLADQLGFVLGPMLAALLLGLWRWEWVVGATGTLFLLADAALLL
WHRTSGFRAAEPPPPAPGHWTLPLRIALRHVLMLPGLKKVVLLAAAENLVIGVTLATSAA
MVTGLHAQSNRYYAGLQTAGAVATVLILLTIARAAWPARTLGLVAFVSICAGGVIAGASA
APWGYALGFLLIVGFDKMFNVYIRSARQQIIPAQDYGKTTGVVILLNNMTQPLAGLLVSV
FSARTQTGPLIVILSLTMGGIGAAVSIGAALVRRKQRALALGE