Protein Info for BPHYT_RS06200 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20706: GT4-conflict
  • amino acids 184 to 386 (203 residues), 30.6 bits, E=3.7e-11
• PF00534: Glycos_transf_1
  • amino acids 225 to 382 (158 residues), 118 bits, E=6.7e-38
• PF13692: Glyco_trans_1_4
  • amino acids 231 to 371 (141 residues), 105.2 bits, E=7e-34
• PF13524: Glyco_trans_1_2
  • amino acids 311 to 388 (78 residues), 39 bits, E=1.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1259)

Predicted SEED Role

"Alpha-1,4-N-acetylgalactosamine transferase PglH (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See B2T263 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BPHYT_RS06200 glycosyl transferase (Burkholderia phytofirmans PsJN)
MTNVNPHSVEADRTPLRILFHINDFGKGGTETALLSWLKTLDRSQFAPSLSVAYPTDDLT
FWRAQSIPEDVPVHVLASSKWMYALHQAARVRKLGTGEKLLHKLSTYGAIRPLLALRMRH
LVRQHDLVCDFDFSLRHMAGSCNVPWFGVNHFSLAARLGSKSARYIARRVRHYARYSAIT
VLIPAMLHEARELFSTTGVDMDIVELPNVIDVDALRSAARAEIKRPAESFIVSVARLDEG
QKDHKTLLRAYAQLRESGRCEAALVLIGDGRDRGELEQLAEQLGIGASVQFLGFCANPLP
YIRQAEMLVLSSRYEGCAVVLGEAMALGTPVLSTDCPTGPRDMLEGGKAGLLVPIGDVDA
MALAMERLLTDTELRRSVAQAALQKVETFTPPRANQRMLDLALRLLAKQGSPSGVLEAR