Protein Info for BPHYT_RS06165 in Burkholderia phytofirmans PsJN
Annotation: rhodanese
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y1252_PARPJ: UPF0176 protein Bphyt_1252 (Bphyt_1252) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
KEGG orthology group: K07146, UPF0176 protein (inferred from 100% identity to bpy:Bphyt_1252)Predicted SEED Role
"Rhodanese domain protein UPF0176, Betaproteobacterial subgroup"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T256 at UniProt or InterPro
Protein Sequence (287 amino acids)
>BPHYT_RS06165 rhodanese (Burkholderia phytofirmans PsJN) MSIVNLSSYHFATIEDTAAWRPFVTERCNALGLKGTILLAPEGINLFVAGTRENTDAFIH YIRHDALFEGKFVDLQFKESLSDKQPFTRMLVKLKREIITMKKPAIRPELGRAPFVDAPT LKHWLDRGHDDQGRPVVMLDTRNAFEVDVGTFDNALDYRITKFSEFPEVIEQNRADLEGK TVVSFCTGGIRCEKAAIHMKEVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN PQLEPSKTTQCFGCRAVVPPQAQESPLYVAGKTCPECHPDSKAARAA