Protein Info for BPHYT_RS05945 in Burkholderia phytofirmans PsJN

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 153 to 169 (17 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 273 to 276 (4 residues), see Phobius details amino acids 287 to 290 (4 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details PF02417: Chromate_transp" amino acids 19 to 183 (165 residues), 84 bits, see alignment E=6.5e-28 amino acids 237 to 390 (154 residues), 91 bits, see alignment E=4.5e-30

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to bpy:Bphyt_1208)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T212 at UniProt or InterPro

Protein Sequence (402 amino acids)

>BPHYT_RS05945 chromate transporter (Burkholderia phytofirmans PsJN)
MQMITSQNAARRGEREPLWTLFRVVFGLSALSWGGLALMAQLENHYVEREGRLSRVAFSD
LIALAWMVPGPVGCNVAVQLGHALRGRAGAWVAGIASVLPFFMLMTLFAIFYRTPFVRSA
ASPTLLNHFSVVLATLIAITWYKQTRALVRGKLEWMAAALGCIALFYARSPAAYVVMLGA
AFGTGWFVSPVRDSRVIVSFARGDWQMLSALSIFLALFAMPLPHRYELALLWPRLAGAGM
TLFGGGFSALPVLKTLFVTPAIGVSDNDFTLAFSLSPLSPGPLLNVVPFFGYLVDGWVGA
LIATLALFVPSGCLVVLAQRHLHQLKANPRFEHGMRILRAVTTAFLAVAVLRIAAHVPFK
PIYLLTALFSAMCFAKLKVPVYVVYGTVAVVCGLWLAYGALI