Protein Info for BPHYT_RS05940 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details PF05425: CopD" amino acids 49 to 148 (100 residues), 66.8 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_0919)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T211 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BPHYT_RS05940 membrane protein (Burkholderia phytofirmans PsJN)
MNKAIELALFLHLLAVAVWVGGMVFAHFCLRPAIADLSPQLRLPLWESVFGRFFNWVAAS
VLVILLTGGFLLMQFGGGHATWPLHAMAGLGIVMMLIFGHIRFAVFPRIRRAVQAQKWPD
GARAVGTIRRLVLINIVLGVVTIGVAVLSRGF