Protein Info for BPHYT_RS05875 in Burkholderia phytofirmans PsJN

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 12 to 319 (308 residues), 110.5 bits, see alignment E=4.8e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1193)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1Z7 at UniProt or InterPro

Protein Sequence (354 amino acids)

>BPHYT_RS05875 acyltransferase (Burkholderia phytofirmans PsJN)
MRDGGNMKKIEQIQYLRAFAALLVVAYHAPATVARFSDALPQLRVGAFGVDIFFVISGFI
MGLLGETGKGGRLDFILKRIVRIVPMYWIVTLLTVCLVLIAPHQMRSTVVDVPSMVKSLL
FIPHFSLGHPGSVWPIVVPGWTLSYEMFFYAVFAVVIPAARLTRATFVSMVFAALAISGF
VFHPANPVALTFTSTLLLEFVMGVWIAVACRQNVLPSRMLAWILLVVAVLMLYTKGAESR
GIDKGVPAAAIVLGSLVVLRHFRSRLLGLIGDASYSIYLMQFFSFGMTRALWETLGITSS
APLSAASYVVFSITGSVVTGVATYWFVERPMSAYLGGLVRQRSAIGPASVAAQS