Protein Info for BPHYT_RS05560 in Burkholderia phytofirmans PsJN

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF00158: Sigma54_activat" amino acids 39 to 204 (166 residues), 221.6 bits, see alignment E=1.3e-69 PF14532: Sigma54_activ_2" amino acids 40 to 209 (170 residues), 64.2 bits, see alignment E=4e-21 PF00004: AAA" amino acids 63 to 182 (120 residues), 30.9 bits, see alignment E=8.5e-11 PF07728: AAA_5" amino acids 63 to 197 (135 residues), 36.2 bits, see alignment E=1.5e-12 PF02954: HTH_8" amino acids 301 to 341 (41 residues), 36.4 bits, see alignment 8.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1133)

Predicted SEED Role

"Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1T8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BPHYT_RS05560 Fis family transcriptional regulator (Burkholderia phytofirmans PsJN)
MASIDLASPTVSGGGNASAMAKQRVADGIVGLKSYGLLYGSSPVMLDLYQQIERFAGTDA
TALIIGESGTGKELIARTIHDQSNRKEAPFVAVNCGAIPDELIEAELFGHEKGSFTGAVQ
GRVGYFEHANGGTLFLDEITEMAPVRQVKLLRALETGTFYRVGGNDLISGNVRVIAATNR
DPAIAVKENGLREDLMYRLAVFPLRAPPLRERENDRELLAQHFLALLNQQEGTSKSFSKR
SIETLRTWSWPGNVRELKNAVYRAFILAEKIVELPHPHLASRVKKPMTQGDAMSVWIGTP
LADAQKQIILGTLKYCGGDKRRAAKALGVSLKTLYNRLSAYGDESAEDEPEQ