Protein Info for BPHYT_RS05360 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 374 to 398 (25 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 398 (363 residues), 165 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 42% identical to ABAQ_ACIBT: Quinolone resistance transporter (abaQ) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1093)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1F3 at UniProt or InterPro

Protein Sequence (439 amino acids)

>BPHYT_RS05360 MFS transporter (Burkholderia phytofirmans PsJN)
MASPANPLHHPGAGAPPSTFEEATYRKVSWRLAPLLMLCYVVAYLDRVNVGFAKLQMTSD
LGLSDAVYGFGAGIFFVGYFIFEIPSNVILHKVGARVWIARIMVSWGVISMLTMFVTTPT
MFYVMRFLLGLAEAGFFPGIILYLTYWYPAHRRGRMTTWFMTAIALSGVIGGPVSGYILK
TFNGMNGWHGWQWLFLLEGIPSVIVGIMVFTMLDDRISKAKWLTKEEQQLLERHVSAEEA
TKHDMPIRQVLTSGRVLMLSLTYFSFVMGLYGVSFWLPTIIKATGVTDAFMIGLLSAIPF
AGAVVAMVFVSRSADRKRERRWHIALPAFAGAVGLVLSVVWAHNTVLAMASLTLATMGIL
TTLPLFWSLPTAILAGTGAAAGIAMINSIGNLAGFLSPYAVGWLKQATAANDSGMYMLAA
FMVLGGLLAISVPAKMVNK