Protein Info for BPHYT_RS05185 in Burkholderia phytofirmans PsJN

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 325 to 351 (27 residues), see Phobius details amino acids 354 to 355 (2 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 384 to 409 (26 residues), see Phobius details PF00654: Voltage_CLC" amino acids 70 to 415 (346 residues), 280.3 bits, see alignment E=1.2e-87

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1059)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1C1 at UniProt or InterPro

Protein Sequence (474 amino acids)

>BPHYT_RS05185 chloride channel protein (Burkholderia phytofirmans PsJN)
MSRSIPIRSSAIVRRARRLWRQYGVFWLGAIAVGLTAVLYARLIDWGYNEFRTVQQQHVW
APLIITPAVTALAVWLTRKFFRGAEGSGIPQVIATLHSRTSAYGSRLLTFRILFGKIAVS
FLAILGGLTIGREGPTVQVGAALMFNLRRLYPRSNALIERQLVLAGAAAGLSAAFNTPLA
GIVFAIEELTRSFEARASGVLITAIIIAGVIALGLNGNYTYFGTIQIGAHFPNVLALAVL
LTAVVTGLAGGVFGWLLLNTARWIPAPLRQLHSERPVAFAALCGFVIAGVGLISGGTTFG
SGYAEARGLLDGHAQLSVFYPFLKMISMVGSYLPGIPGGIFAPSLSIGAGFGDLLYRVFQ
SMDLPMLIALGMVGYLAAVTQSPITSFVIVMEMINGHALVISLMATALISSRVSRLLTPP
LYESLAERYMTPLPQPAPAPTPEVPEVEAPVPAAENVDGEPLADAPNGSNAPRQ