Protein Info for BPHYT_RS05060 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 11 to 81 (71 residues), 71.4 bits, see alignment E=2.3e-24 amino acids 99 to 172 (74 residues), 85.9 bits, see alignment E=6.8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1035)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T197 at UniProt or InterPro

Protein Sequence (206 amino acids)

>BPHYT_RS05060 membrane protein (Burkholderia phytofirmans PsJN)
MHPRLTLALTIMEALAIFAYAISGFIEARTRRLDAVGTFLVAIATAFGGGTLRDVLLERR
PFYWVEHQGYLIAIFVMSLFAPTLLKMTSRLFSERVLLVADAIGLGLFSIGGTSIAHDAQ
MPWFTSVMMGVLTGVFGGVIRDVLCNEVPLILRDSRPYATCAFVGCWLYVLLDYIEFDTV
YSVLIATAFILLARLLTFRFNVRLPH