Protein Info for BPHYT_RS05030 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 297 (196 residues), 43 bits, see alignment E=2.2e-15

Best Hits

Swiss-Prot: 38% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_1029)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T195 at UniProt or InterPro

Protein Sequence (312 amino acids)

>BPHYT_RS05030 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MTASISGNGKTATVTRRASPMAALADRWIPKLVLAPSVVISLIFVYGFIAITGYLSLSNS
RLMPRYEFVGLDRYRELFDNDVFWTSAANLGWFGIPFIGVCIGLGLFLAILLDQQIRNEG
ALRAVFLYPMALSFIVTGTAWQWIMTPSIGLEKVFHDWGWTSFSFSWLGDPDKAIFCVVI
AAVWQSTGFVMALFLAGLRGVDGEIFKAAQMDGAGLPTIYRKIVIPSMRPVFFSVLLILC
HITIKTFDLVVALTAGGPGTSSSLPAIFMYTFSFNRGQLGVGAASSMMMLATVVAVLVPL
MYLESRSTRNAA