Protein Info for BPHYT_RS05010 in Burkholderia phytofirmans PsJN

Annotation: RpiR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00749: glucokinase
  • amino acids 22 to 324 (303 residues), 324.4 bits, E=4e-101
• PF02685: Glucokinase
  • amino acids 22 to 330 (309 residues), 372.8 bits, E=2.7e-115
• PF01418: HTH_6
  • amino acids 345 to 413 (69 residues), 68.1 bits, E=1.1e-22
• PF01380: SIS
  • amino acids 466 to 593 (128 residues), 62.9 bits, E=5.5e-21

Best Hits

Swiss-Prot: 99% identical to GLK_PARXL: Bifunctional protein glk (glk) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to bpy:Bphyt_1025)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2) / HTH-type transcriptional regulator (HexR?)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• heterolactic fermentation (16/18 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• homolactic fermentation (10/12 steps found)
• glycogen degradation II (5/6 steps found)
• trehalose degradation II (cytosolic) (2/2 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• chitin biosynthesis (6/9 steps found)
• trehalose degradation IV (1/3 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

See B2T187 at UniProt or InterPro

Protein Sequence (638 amino acids)

>BPHYT_RS05010 RpiR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MSTGVQTKAVPGAGQHADGPRLLADIGGTNARFALETSPGEIGSVKVYPCADYPGVAEVI
KKYLKDTKIGRVNHAAIAIANPVDGDQVSMTNHDWSFSIEATRRALGFDTLLVVNDFTAL
AMALPGLTDAQRVQVGVGARRPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFA
PADEREDIVLQYARKKWSHVSFERVAAGPGIEVIYRALAGRDKKRVAANVDTIEIVKRAL
EGEPLAAESVDVFCGILGTFAGNIAVTLGALGGIYIGGGVVPRLGEFFSRSSFRKRFEAK
GRFEAYLQNVPTYVITAEYPAFLGVSAILAEQLSNRAGGSSSAVFERIRQMRDALTPAER
RVADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIP
VSHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEQVERAIDLLNGARRIEFYGLGNS
NIVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAM
QAGAKVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLVMIDILAVGVAIRRA
VPSADVAETVAKARQGADDDASAVLDWLSHGAASSARD