Protein Info for BPHYT_RS04975 in Burkholderia phytofirmans PsJN

Annotation: deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 188 (185 residues), 164.4 bits, E=1.1e-52
• PF00692: dUTPase
  • amino acids 83 to 184 (102 residues), 28 bits, E=7.7e-11

Best Hits

Swiss-Prot: 100% identical to DCD_PARPJ: dCTP deaminase (dcd) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to bpy:Bphyt_1019)

MetaCyc: 72% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See B2T181 at UniProt or InterPro

Protein Sequence (189 amino acids)

>BPHYT_RS04975 deoxycytidine triphosphate deaminase (Burkholderia phytofirmans PsJN)
MTIKSDKWIRRMAASHNMIEPFAPDQVRVSEDGRKIVSYGTSSYGYDIRCADEFKIFTNI
NSTIVDPKNFDEKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGI
IVNVTPFEPEWEGHVTLEFSNTTPLPAKIYANEGVAQVLFFESDEICETSYADRGGKYQG
QHGVTLPKT