Protein Info for BPHYT_RS04905 in Burkholderia phytofirmans PsJN

Annotation: quinol oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 68 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details PF07681: DoxX" amino acids 11 to 87 (77 residues), 70.7 bits, see alignment E=6.9e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1006)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T168 at UniProt or InterPro

Protein Sequence (138 amino acids)

>BPHYT_RS04905 quinol oxidase (Burkholderia phytofirmans PsJN)
MNSNRSADLAALLLRVALGVLYLAHSLQKIFVFTLPGTAQFFVSLGLPGWLGYVTAFVEL
FGGVALLLGVQVRWVALVLLPFMLGAMSQHLHNGWGFASPHGGWEYPAFWAVTLAVQSLL
GGGALAFGGARAPRAVAA