Protein Info for BPHYT_RS04890 in Burkholderia phytofirmans PsJN

Annotation: cobalamin biosynthesis protein CobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 66 to 92 (27 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details PF03186: CobD_Cbib" amino acids 13 to 287 (275 residues), 298.1 bits, see alignment E=6.6e-93 TIGR00380: cobalamin biosynthesis protein CobD" amino acids 13 to 302 (290 residues), 177.7 bits, see alignment E=1.7e-56 PF17113: AmpE" amino acids 38 to 227 (190 residues), 26.6 bits, see alignment E=4e-10

Best Hits

Swiss-Prot: 56% identical to COBD_PSEAE: Cobalamin biosynthesis protein CobD (cobD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to bpy:Bphyt_1003)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.10

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T165 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BPHYT_RS04890 cobalamin biosynthesis protein CobD (Burkholderia phytofirmans PsJN)
MLSLPLLVTLATAGVAVDRWFGEPRAAHPLVGFGNWAKRLETRYNTGRRLRLKGLLAWSL
AVMPPVLIAWCLVAVLPFYAACVVHVLLLWFALGARSLHEHIAPIAQALVQRDLAQARLL
TARIVSRETADADEGALSRAAVESALENGNDAIFGALFWFAVAGGPGALAFRLANTLDAM
WGYRTPRYLRYGWAAARIDDVLNWIPARLTAASYALLGDTRTAWRCWREQAPRWDSPNAG
PVMASGAGSLNVLIGGPAVYHGALEHRPTLGFGHTAKASHVSAALMLVERTVILWLAVLI
VLALLSVPFHG