Protein Info for BPHYT_RS04860 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00005: ABC_tran" amino acids 30 to 177 (148 residues), 100.4 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 40% identical to HMUV_PSEAE: Hemin import ATP-binding protein HmuV (hmuV) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to bpy:Bphyt_0997)

Predicted SEED Role

"Iron(III) dicitrate transport ATP-binding protein fecE"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T159 at UniProt or InterPro

Protein Sequence (280 amino acids)

>BPHYT_RS04860 ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MQTRHAPSHDATLGAQRLTLRAGARTLLDAFTHTFYAGEIWCIAGPNGAGKTTLLSTLAG
LLQPSAGHVELDGVRLADWPPLSLAQRRALMPQSAPDAFSASVLDIVMLNRFPHLTGWGW
EREADREAAHAALDLLGLAAFAARDVLSLSGGERQRVALAAVLCQDAPLLLLDEPLAHLD
LHHQIDCLEALAAWTRAPRRTVMFSCHDLNFARRFATHALLLDGAGGAYAGPVHDVLTPT
LASRAFGYPLLLIRDGEHEALIPAPRARHESPAGHDAPAS