Protein Info for BPHYT_RS04825 in Burkholderia phytofirmans PsJN

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 260 to 286 (27 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 4 to 290 (287 residues), 283.4 bits, see alignment E=9.6e-89 PF01790: LGT" amino acids 9 to 285 (277 residues), 271 bits, see alignment E=4.2e-85

Best Hits

Swiss-Prot: 100% identical to LGT_PARPJ: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to bpy:Bphyt_0990)

MetaCyc: 55% identical to phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (Escherichia coli K-12 substr. MG1655)
RXN0-20 [EC: 2.5.1.145]

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.- or 2.5.1.145

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T152 at UniProt or InterPro

Protein Sequence (301 amino acids)

>BPHYT_RS04825 prolipoprotein diacylglyceryl transferase (Burkholderia phytofirmans PsJN)
MLIHPNFDPIAIHLGPLAVRWYGLMYLVAFIAAIVVGRLRLRLPYVAAQGWTVKDIDDML
FYGVLGTILGGRLGYVLFYKASFYFAHPLDIFKVWEGGMSFHGGFLGVTLAMVLFAYQRK
RSWLQVTDFVAPMVPTGLAAGRLGNFINGELWGRVTDPSSPWAMLFPGAAPDDAAWLTAH
PQLAAQWHLNEVFAQYHMLPRHPSELYEIALEGVALFFVLIFFSRKPKPMGAISAVFLIG
YGLARFTVEFAREPDDFLGLLAMGLSMGQWLSLPMILVGIGLLVWSYRRARHEPAQAVSV
N