Protein Info for BPHYT_RS04790 in Burkholderia phytofirmans PsJN

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 49 to 77 (29 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 345 (344 residues), 388.3 bits, see alignment E=1.3e-120 PF03739: LptF_LptG" amino acids 7 to 345 (339 residues), 174.6 bits, see alignment E=1.5e-55

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 100% identity to bpy:Bphyt_0983)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T145 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BPHYT_RS04790 permease (Burkholderia phytofirmans PsJN)
MIFERSLQRELAYTAGAVFMVLLTLVLTTMMIRIVGFAASGEIDPRDVLVLIGLTVIGYL
AIMLVATLFVSILFVLTRWYKDSEMVVWLSSGVSLTQFIKPIGIFATPIIILIMFFVFVG
WPWSNQQSKLIRARFQQRDEVSLLAPGQFRESATSHRVFFIEKMSADQARVENVFVTSTE
NGKVNVVVSKTGHTETRKNGDRFVVLENGRRYDGQPGQPDFRIMEFERYGVKIQSQPVVN
TPSTTGTPTLTLLRNPTNDNLAEFAWRAGLPLIAINLMLLAIPLAHQNPRRSRTINLVMA
VLIYLTYSNLLNVVQSWIEQGKMSFPVGLVGLHVIVAAIVAFIFWLRVRNRPLFTRAMFS
RSQGA