Protein Info for BPHYT_RS04785 in Burkholderia phytofirmans PsJN

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 3 to 378 (376 residues), 342.1 bits, see alignment E=1.3e-106 PF03739: LptF_LptG" amino acids 6 to 376 (371 residues), 283.4 bits, see alignment E=1.2e-88

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 100% identity to bxe:Bxe_A3640)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T144 at UniProt or InterPro

Protein Sequence (382 amino acids)

>BPHYT_RS04785 permease (Burkholderia phytofirmans PsJN)
MRIYERYFARQIYLTFIFILFAFSGLFFFFDLINELNSVGHGNYKFQYAVLRVALQTPSR
FYEIIPVAALISAIYVFAQMAANSEYTIFRVSGLATNQALRSLLKIGIPLVLLTYLIGEV
VGPYTDQLSERVRLEALGSSVSSNFESGVWVKDTLTARADGEQVTRFVNVGELKPDATIS
NVRIYEFDSKFRLSNVRTAKSGKYQPPGHWQLTGVTDTQLIDVPPPPGTPADALNPVYRA
KEVAVPEYSLRSELTPQILSVLLVSPDRMSMFNLFRYIQHLTENHQDTQRYEIALWRKLL
YPFAVFVMLVLSLPFAYLHTRAGVVGMKVFGGIMLGMSFQLFNTLFSHIGTLNTWPAPLT
AATPGLVYLVLGLVGLKWVDRH