Protein Info for BPHYT_RS04685 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF00005: ABC_tran" amino acids 20 to 169 (150 residues), 111.3 bits, see alignment E=6.1e-36 amino acids 271 to 423 (153 residues), 75.4 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 46% identical to RGMG1_BURL3: Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 (Bcep18194_B0624) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to bpy:Bphyt_0962)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T124 at UniProt or InterPro

Protein Sequence (495 amino acids)

>BPHYT_RS04685 ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MSLAIRFDDIRKDFGPVRVLHGVSFELAPGRIYGLLGENGAGKSTLMKILAGYETATSGT
LLVDGQAHQFIGSRDAEAQGIVLIHQEFNLAEHLTIAQNMYLGHEKKRGWFVDDAAMNTE
AARFLAQVGLEKAPDTKVRELIVAEKQMVEIAKALSRRARLLIMDEPTATLTPSETERLF
TLMAKLKADGVTIIYISHKLDEVERITDEVIVMRDGRFVARGETAGLARQQMANLMVGRE
LSDMFPDKITVSADAPLALKVEGLAVPDWVEDLSFDVHAGEVLGFAGLVGAGRTEAFEAI
IGLRKRTAGRIEVAGRPADLKSPRDAMRHGITYLSEDRKGKGLHVNLSLQDNVTLMTLER
YAHPLLDMKAGRAALTKAVSEFGIRTGDLSSRARMLSGGNQQKLALAKYLQPDPNVIVLD
EPTRGVDVGAKRDIYFLIHRLAAQGRAVIVISSELIELIGLCHRVAVMRAGRLQATLTLD
HLTEEELIAHATGTH