Protein Info for BPHYT_RS04640 in Burkholderia phytofirmans PsJN

Annotation: branched-chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 32 to 388 (357 residues), 238.9 bits, see alignment E=1.3e-74 TIGR03407: urea ABC transporter, urea binding protein" amino acids 33 to 405 (373 residues), 591.9 bits, see alignment E=2.1e-182 PF13433: Peripla_BP_5" amino acids 33 to 407 (375 residues), 548.1 bits, see alignment E=9.8e-169

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_0954)

Predicted SEED Role

"Urea ABC transporter, urea binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T116 at UniProt or InterPro

Protein Sequence (431 amino acids)

>BPHYT_RS04640 branched-chain amino acid ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MKRRSLLKFGSMSGALALAGQVPFAQAQSSGPIKVGILHSLSGTMAISETSLKDTALMTI
ADINKNGGVMGRQLEPVVVDPASNWPLFAEKARQLITQDKCAVVFGCWTSVSRKSVLPVF
EELNGLLFYPVQYEGEEMSRNVFYTGAAPNQQAIPATEYLMSAEGGGAKRFFLLGTDYVY
PRTTNKILRAFLKSKGVQEADIQEVYTPFGHSDYQTIVANIKTFSQGGKTAVISTVNGDS
NVPFYKELGNQGLKASDVPVVAFSVGEEELRGIDTKPLVGNLAAWNYFMSLRNPANEKFK
KQWAAWVAQNNLPGGTKRVTNDPMEATFVGIHMWKQAVEKAKSTEVDKVRVAMVGQTFAA
PSGFTLEMDGNHHLHKPVMIGEVRADGQFNVVWRTKTAIRAQPWSPFIAGNSSKPDVVSS
IPAFLKRSRVA