Protein Info for BPHYT_RS04630 in Burkholderia phytofirmans PsJN

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 72 to 123 (52 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 70 to 383 (314 residues), 434.4 bits, see alignment E=1.8e-134 PF02653: BPD_transp_2" amino acids 77 to 372 (296 residues), 139.1 bits, see alignment E=7.7e-45

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_0952)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T114 at UniProt or InterPro

Protein Sequence (394 amino acids)

>BPHYT_RS04630 amino acid ABC transporter permease (Burkholderia phytofirmans PsJN)
MTSATSSAHVGATSGGAGAGREPQSGFALGLPPRPALLSRRAWLALIALIVVFGLGVPFC
TLVVPETSALHLSAYAMTITGKFMCYAIAALALDLVWGYCGILSLGHALFFALGGYAIGM
YLMRSIGHEGKYGSDLPDFMVFLDWHQLPWYWQGTQHLGYALLLVVLVPAVVAWVFGFFT
FRSRVKGVYLSIITQAMTFAAMLLFYRNETGFGGNNGFTDFKRIGGFPITHPGTRTALLL
ITFAVLILAFLGARAIVTSKLGRVVTAVRDGETRLMFLGYSPLAYKLFVWTVSAVLCGIA
GALYVPQVGIINPGEMSPGNSIEMAIWVAVGGRGTLIGPIIGAFAVNGAKSFFTANFPEY
WLFFLGLIFVLVPLFLPNGIMGLIDLVTRKRNRS