Protein Info for BPHYT_RS04495 in Burkholderia phytofirmans PsJN

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 20 to 216 (197 residues), 334.7 bits, E=9.4e-105
• PF02492: cobW
  • amino acids 22 to 192 (171 residues), 140.1 bits, E=3.1e-45

Best Hits

Swiss-Prot: 97% identical to UREG_PARXL: Urease accessory protein UreG (ureG) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03189, urease accessory protein (inferred from 100% identity to bpy:Bphyt_0925)

MetaCyc: 64% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Sequence Analysis Tools

See B2T0P2 at UniProt or InterPro

Protein Sequence (217 amino acids)

>BPHYT_RS04495 urease accessory protein UreG (Burkholderia phytofirmans PsJN)
MNAPHQPAHSSVRTKKLPPLRVGVGGPVGSGKTTLLEMLCKAMREQYDLVAITNDIYTKE
DQRLLTVAGALPAERIMGVETGGCPHTAIREDASINLEAVDRMLTRFPDADIVFIESGGD
NLAATFSPELSDLTIYVIDVAGGEKIPRKGGPGITKSDLLVINKTDLAPMVGANLDVMAS
DAKKMRGERPFVMCNLKALDGLEVVVRFIEEKGLLKV