Protein Info for BPHYT_RS04470 in Burkholderia phytofirmans PsJN

Annotation: phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 5 to 141 (137 residues), 112.1 bits, E=3.4e-36
• PF02879: PGM_PMM_II
  • amino acids 158 to 256 (99 residues), 101 bits, E=1e-32
• PF02880: PGM_PMM_III
  • amino acids 261 to 367 (107 residues), 80.5 bits, E=2.2e-26
• PF00408: PGM_PMM_IV
  • amino acids 375 to 453 (79 residues), 45.4 bits, E=1.4e-15

Best Hits

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to bpy:Bphyt_0920)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucomutase (EC 5.4.2.2) / Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.2, EC 5.4.2.8)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• peptidoglycan recycling I (10/14 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• chitin biosynthesis (6/9 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• starch degradation III (2/4 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• starch biosynthesis (6/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.2 or 5.4.2.8

Sequence Analysis Tools

See B2T0N7 at UniProt or InterPro

Protein Sequence (464 amino acids)

>BPHYT_RS04470 phosphoglucomutase (Burkholderia phytofirmans PsJN)
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVQA
LSDGLREAGVDVVNVGMVPTPVGYFAASVPLQLDGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQILALHQRIVDENFSTGSGTYTEYDIADAYLERITSDIKLARPIKIVVDT
GNGVAGGLAPKLFKKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGEIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVEDP
SKLLNSLPNSNSTPELQLKLEEGENFELIARLQQNAKFTGADDVVKIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVIMAEKPDAKLPF