Protein Info for BPHYT_RS04450 in Burkholderia phytofirmans PsJN

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 5 to 135 (131 residues), 30 bits, E=1.9e-10
• PF04321: RmlD_sub_bind
  • amino acids 6 to 165 (160 residues), 32.9 bits, E=1.5e-11
• PF00106: adh_short
  • amino acids 6 to 74 (69 residues), 27.2 bits, E=1.1e-09
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 7 to 338 (332 residues), 442.8 bits, E=3.2e-137
• PF01370: Epimerase
  • amino acids 7 to 265 (259 residues), 186.3 bits, E=2.6e-58
• PF02719: Polysacc_synt_2
  • amino acids 7 to 186 (180 residues), 46.6 bits, E=1.1e-15
• PF01073: 3Beta_HSD
  • amino acids 8 to 163 (156 residues), 46.6 bits, E=9.9e-16
• PF16363: GDP_Man_Dehyd
  • amino acids 8 to 327 (320 residues), 190.7 bits, E=2e-59

Best Hits

Swiss-Prot: 65% identical to GALE_BACSU: UDP-glucose 4-epimerase (galE) from Bacillus subtilis (strain 168)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to bpy:Bphyt_0916)

MetaCyc: 65% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See B2T0N3 at UniProt or InterPro

Protein Sequence (340 amino acids)

>BPHYT_RS04450 UDP-glucose 4-epimerase (Burkholderia phytofirmans PsJN)
MTTKGTILVTGGAGFIGSHTCVELLNGGYDVVVIDNLVNSNRESLRRVEKITGKAVTFYE
ADARDEAALNRIFDAHPITGAIHFAALKAVGESVAKPIEYYSNNVGSLLTLLGVMRDRNV
KQFVFSSSATVYGVPKSSPIDESFPLSATNPYGQSKLIAEQVLRDLELADPSWRIATLRY
FNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGGDYETPDGTGVRDYIHVV
DLARGHLAALDALVKRDASFVVNLGTGQGYSVIDVVKAFEKAAGRPVPYEIVARRPGDVA
SCFADPAAAEKIIGWRAQFGIERMCADHWRWQSTNPQGFA