Protein Info for BPHYT_RS04435 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 255 to 271 (17 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 30 to 291 (262 residues), 142.2 bits, see alignment E=3.6e-45 PF00005: ABC_tran" amino acids 407 to 567 (161 residues), 102.7 bits, see alignment E=5.1e-33 PF12399: BCA_ABC_TP_C" amino acids 616 to 639 (24 residues), 45 bits, see alignment (E = 1.2e-15)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_0913)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0N0 at UniProt or InterPro

Protein Sequence (646 amino acids)

>BPHYT_RS04435 ABC transporter (Burkholderia phytofirmans PsJN)
MNPKKLVASALALIALAVFPVLSGNPYYIHLLETIMIYAILLFGLDIVVGYTGQVSLGHA
GLFGVGAYTAGVLFFKLGMPFIVTAPLAILITAAFGAILALPALRVSGPYLAMVTLAFGT
ILQILINEMDFLTNGPMGVKIPKPSLAGRPMNEVEYYWLVAALLVASLIVVHRVLRSHLG
RAFEALRDSPIASDCMGVSVYRYKVYAFVISAGFAGLAGCLYSYSEQYISPNTYNFELTI
LFLLAIIMGGRKTRTGALLGSAIIVLLPKLLDDIDMFRTVASVLAAVVVIGAGVALARKV
STPRKVAIPVLGTAGLAAFSYRIETLADWRLTIFGLMILLVVYYLQDGVVGFVRKIVMHG
RVRTVTVDATQPATSGGDAVQAVHAGGTEDILQLRGILMQFSGLKALNDVDLTVQRGTIH
GLIGPNGSGKSTMMNVLTGIYVPTAGTLEYRGASLAGKTSAQIALSGIARTFQNVQLFGE
MTALENVLVGLHHTFNANLADVGLMSSRYRREERAARERAFGMLRFVGLDNVAAEEARNL
PYGKQRLLEIARALALDPQLLLLDEPAAGLTAPDIKELVAIIRKVRDHGITVVLIEHHMD
VVMSVCDRVSVLDFGQKIAEGKPADIQSNEKVIEAYLGGQPADQAA